TIMM10B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TIMM10B Polyclonal antibody, PBS Only (10907-1-PBS)

• 

  IHC staining of human heart using 10907-1-AP (same clone as 10907-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 10907-1-AP (TIMM10B antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 10907-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 10907-1-AP (same clone as 10907-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 10907-1-AP (TIMM10B antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 10907-1-PBS in a different storage buffer formulation.

TIMM10B Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 10907-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

10907-1-PBS targets TIMM10B in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1355

  Product name: Recombinant human FXC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-103 aa of BC011014

  Sequence: MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPSVAAEQPGVSPSGS

• Full Name: fracture callus 1 homolog (rat)
• Calculated Molecular Weight: 12 kDa
• GenBank Accession Number: BC011014
• Gene Symbol: TIMM10B
• Gene ID (NCBI): 26515
• RRID: AB_2105508
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5J6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.