TIMM17B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TIMM17B Polyclonal antibody (11062-1-AP)

• Featured Product
• KD/KO Validated

TIMM17B Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 11062-1-AP Copied!

Publications (10)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

DXS9822, JM3, Mitochondrial import inner membrane translocase subunit Tim17-B, TIM17B

• 

  WB analysis of mouse heart using 11062-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11062-1-AP (TIMM17B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 11062-1-AP

  WB result of TIMM17B antibody (11062-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TIMM17B transfected PC-3 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 11062-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11062-1-AP (TIMM17B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of PC-3 using 11062-1-AP

  IP result of anti-TIMM17B (IP:11062-1-AP, 4ug; Detection:11062-1-AP 1:1000) with PC-3 cells lysate 1575 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 11062-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11062-1-AP (TIMM17B antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TIMM17B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse liver tissue, PC-3 cells
• Positive IP detected in: PC-3 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11062-1-AP targets TIMM17B in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1504

  Product name: Recombinant human TIMM17B protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-172 aa of BC010142

  Sequence: MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH

• Full Name: translocase of inner mitochondrial membrane 17 homolog B (yeast)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 17-20 kDa
• GenBank Accession Number: BC010142
• Gene Symbol: TIMM17B
• Gene ID (NCBI): 10245
• RRID: AB_2201995
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60830
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TIMM17B Polyclonal antibody (catalog number 11062-1-AP) has 10 total citations. These appear in journals including Cell Metabolism, Molecular Cell, Cell Reports, Journal of Cell Biology, Scientific Reports, American Journal of Physiology, Cancer Research Communications, Infection and Immunity, and Cell Molecular Biology. The research fields span mitochondrial protein import/translocation (TIM22/TIM23/TIM17B), Sengers syndrome, T-cell metabolism, skeletal muscle metabolism, lung carcinoma, breast cancer, and infectious disease.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Metab; Acylglycerol Kinase Maintains Metabolic State and Immune Responses of CD8+ T Cells.; Authors - Zhilin Hu
human	WB	Mol Cell; Acylglycerol Kinase Mutated in Sengers Syndrome Is a Subunit of the TIM22 Protein Translocase in Mitochondria.; Authors - Milena Vukotic
human	WB	Mol Cell; Sengers Syndrome-Associated Mitochondrial Acylglycerol Kinase Is a Subunit of the Human TIM22 Protein Import Complex.; Authors - Yilin Kang
human		Cell Rep; TIM23 facilitates PINK1 activation by safeguarding against OMA1-mediated degradation in damaged mitochondria; Authors - Shiori Akabane
human	WB	J Cell Biol; ROMO1 is a constituent of the human presequence translocase required for YME1L protease import.; Authors - Frank Richter
		Sci Rep; The presence of disulfide bonds reveals an evolutionarily conserved mechanism involved in mitochondrial protein translocase assembly.; Authors - Lidia Wrobel

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

The single review for this product reports a positive experience. The customer used it for Western Blot on heart tissue at a 1:1000 dilution and rated it 4 out of 5, describing the performance simply as "good." Overall, the feedback indicates the antibody performed well for its intended application.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Angela (Verified Customer) (12-27-2024)

good

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: heart tissue

TIMM17B Antibody Western Blot validation (1:1000 dilution) in heart tissue (Cat no:11062-1-AP)