TIMM44 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85134-6-RR (same clone as 85134-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85134-6-RR (TIMM44 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85134-6-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 85134-6-RR (same clone as 85134-6-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 85134-6-RR (TIMM44 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85134-6-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 85134-6-RR (same clone as 85134-6-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using TIMM44 antibody (85134-6-RR, Clone: 242774F9 ) at dilution of 1:2000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85134-6-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 85134-6-RR (same clone as 85134-6-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug Timm44 Recombinant Antibody (85134-6-RR, Clone:242774F9) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 85134-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85134-6-RR

  Biolayer interferometry (BLl) kinetic assays of 85134-6-RR against Human TIMM44 were performed. The affinity constant is below 1 pM.

TIMM44 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 85134-6-PBS

Clone No.242774F9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

MIMT44, TIM44, TIMM 44

---

Product Information

85134-6-PBS targets TIMM44 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4834

  Product name: Recombinant human TIMM44 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 153-452 aa of BC033628

  Sequence: AKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQIL

• Full Name: translocase of inner mitochondrial membrane 44 homolog (yeast)
• Calculated Molecular Weight: 452 aa, 51 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC033628
• Gene Symbol: TIMM44
• Gene ID (NCBI): 10469
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43615
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Translocase of inner mitochondrial membrane 44 (TIMM44), also known as MIMT44 and TIM44, belongs to the Tim44 family. TIMM44 is a mitochondrial protein located at the inner mitochondrial membrane, which is crucial for the integrity and function of mitochondria. In an ATP-dependent manner, TIMM44 anchors mitochondrial heat shock protein 70 to the translocase of the mitochondrial inner membrane 23 (TIMM23) complex. TIMM44 is essential for mitochondrial pre-protein import into the mitochondrial matrix. TIMM44 is vital for the integrity and function of mitochondria. TIMM44 silencing disrupted mitochondrial functions in endothelial cells, causing mitochondrial protein input arrest, ATP reduction, ROS production, and mitochondrial depolarization, and leading to apoptosis activation (PMID: 36438483, PMID: 37147302, PMID: 38467612). The observed molecular weight of TIMM44 is 45 kDa, indicating a mature form of TIMM44 (PMID: 33891006).