TIMM50 Polyclonal antibody

• 

  WB analysis using 22229-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22229-1-AP (TIMM50 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 22229-1-AP

  IP result of anti-TIMM50 (IP:22229-1-AP, 4ug; Detection:22229-1-AP 1:1000) with HeLa cells lysate 3200ug.

• 

  IHC staining of human liver using 22229-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver slide using 22229-1-AP (TIMM50 Antibody) at dilution of 1:50.

• 

  IHC staining of human kidney using 22229-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney slide using 22229-1-AP (TIMM50 Antibody) at dilution of 1:50.

• 

  IHC staining of human liver using 22229-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver slide using 22229-1-AP (TIMM50 Antibody) at dilution of 1:50.

• 

  IHC staining of human kidney using 22229-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney slide using 22229-1-AP (TIMM50 Antibody) at dilution of 1:50.

• 

  IF Staining of HepG2 using 22229-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 22229-1-AP (TIMM50 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

TIMM50 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 22229-1-AP

Publications(14)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, RIP, ELISA

Synonyms

PRO1512, TIM50, TIM50L

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human kidney tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 10 publications below
• IF: See 1 publications below
• IP: See 1 publications below
• RIP: See 2 publications below

Product Information

22229-1-AP targets TIMM50 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17574

  Product name: Recombinant human TIMM50 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 190-456 aa of BC121147

  Sequence: GNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP

• Full Name: translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae)
• Calculated Molecular Weight: 456 aa, 50 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC121147
• Gene Symbol: TIMM50
• Gene ID (NCBI): 92609
• RRID: AB_2879039
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q3ZCQ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; The HRI branch of the integrated stress response selectively triggers mitophagy; Authors - Yogaditya Chakrabarty
	WB	EMBO J; Poldip2 promotes mtDNA elimination during Drosophila spermatogenesis to ensure maternal inheritance; Authors - Ziming Wang
human		Cell Rep; TIM23 facilitates PINK1 activation by safeguarding against OMA1-mediated degradation in damaged mitochondria; Authors - Shiori Akabane
human	WB	Elife; Genome-wide CRISPRi screening identifies OCIAD1 as a prohibitin client and regulatory determinant of mitochondrial Complex III assembly in human cells.; Authors - Maxence Le Vasseur
mouse	RIP	Front Cell Dev Biol; The Novel Non-coding Transcriptional Regulator Gm18840 Drives Cardiomyocyte Apoptosis in Myocardial Infarction Post Ischemia/Reperfusion.; Authors - Changjun Luo
human	WB	Front Cell Dev Biol; Applying Sodium Carbonate Extraction Mass Spectrometry to Investigate Defects in the Mitochondrial Respiratory Chain.; Authors - David R L Robinson