Tested Applications
| Positive WB detected in | A2780 cells, HT-29 cells, SKOV-3 cells |
| Positive IHC detected in | mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SKOV-3 cells, HT-29 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
Product Information
26847-1-AP targets TIMP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25395 Product name: Recombinant human TIMP1 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 58-207 aa of BC000866 Sequence: YQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA Predict reactive species |
| Full Name | TIMP metallopeptidase inhibitor 1 |
| Calculated Molecular Weight | 23 kDa |
| Observed Molecular Weight | 23-28 kDa |
| GenBank Accession Number | BC000866 |
| Gene Symbol | TIMP1 |
| Gene ID (NCBI) | 7076 |
| RRID | AB_3085910 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01033 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TIMP1 is a member of the family of matrix metalloproteinase inhibitors, which contains four members (TIMP1, TIMP2, TIMP3, and TIMP4). Tissue inhibitors of metalloproteinases (TIMPs) are multifaceted molecules that exhibit properties beyond their classical proteinase inhibitory function. TIMP1 has several MMP-independent functions such as modulation of angiogenesis, promotion of cell proliferation, and inhibition of apoptosis. TIMP1 plays important role in cell cycle regulation and cancer progression. Recently, clinical studies have shown that the aberrant expression of TIMP1 is associated with an unfavorable prognosis in a series of tumors, such as gastric cancer, papillary thyroid carcinoma, cutaneous melanoma and breast cancer. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TIMP1 antibody 26847-1-AP | Download protocol |
| IHC protocol for TIMP1 antibody 26847-1-AP | Download protocol |
| WB protocol for TIMP1 antibody 26847-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
BMC Cardiovasc Disord Baricitinib represses the myocardial fibrosis via blocking JAK/STAT and TGF-β1 pathways in vivo and in vitro | ||
Acta Pharm Sin B NAT10 inhibition alleviates astrocyte autophagy by impeding ac4C acetylation of Timp1 mRNA in ischemic stroke
| ||
J Biomed Mater Res A Triamcinolone Acetonide (TCA)-Loaded Biodegradable Microspheres Improve Therapeutic Outcomes in Thyroid-Associated Ophthalmopathy (TAO) by Reducing Fibrosis and Adipogenesis. | ||
Bioorg Chem Protopine attenuates hepatic fibrosis via HDAC6-mediated NLRP3 inflammasome activation. | ||
Acta Pharm Sin B A combined nanotherapeutic approach targeting farnesoid X receptor, ferroptosis, and fibrosis for nonalcoholic steatohepatitis treatment. | ||
Invest Ophthalmol Vis Sci Early Transcriptomic and Pathologic Changes of Col8a2 Mutant Fuchs Endothelial Corneal Dystrophy. |











