TIMP1 Recombinant monoclonal antibody, PBS Only

• 

TIMP1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83151-2-PBS

Clone No.230329F11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

TIMP-1, CLGI, Collagenase inhibitor, EPA, Erythroid-potentiating activity

---

Product Information

83151-2-PBS targets TIMP1 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Affinity:
  K_D=1.75 x 10^-11M
  K_Off=5.52 x 10^-6M
  K_On=3.15 x 10^5M
• Immunogen:

  CatNo: Eg0638

  Product name: Recombinant human TIMP1 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-207 aa of BC000866

  Sequence: CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

• Full Name: TIMP metallopeptidase inhibitor 1
• Calculated Molecular Weight: 23 kDa
• GenBank Accession Number: BC000866
• Gene Symbol: TIMP1
• Gene ID (NCBI): 7076
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01033
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.