TIMP1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00245-4

  Sandwich ELISA standard curve of MP00245-4, Human TIMP1 Recombinant Matched Antibody Pair - PBS only. 83151-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg0638. 83151-7-PBS was HRP conjugated as the detection antibody. Range: 15.6-1000 pg/mL

• 

  Sample test of MP00245-4

  Serum of eight individual healthy human donors was measured. The human TIMP1 concentration of detected samples was determined to be 173.6 ng/mL with a range of 108.8 - 221.2 pg/mL.

• 

  Sample test of MP00245-4

  Saliva of eight individual healthy human donors was measured. The human TIMP1 concentration of detected samples was determined to be 60.8 ng/mL with a range of 14.2 - 145.8 pg/mL.

TIMP1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83151-3-PBS

Clone No.230329E8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

TIMP-1, CLGI, Collagenase inhibitor, EPA, Erythroid-potentiating activity

---

Product Information

83151-3-PBS targets TIMP1 as part of a matched antibody pair:

MP00245-4: 83151-3-PBS capture and 83151-7-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Affinity:
  K_D=2.16 x 10^-11M
  K_Off=4.92 x 10^-5M
  K_On=2.28 x 10^6M
• Immunogen:

  CatNo: Eg0638

  Product name: Recombinant human TIMP1 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-207 aa of BC000866

  Sequence: CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

• Full Name: TIMP metallopeptidase inhibitor 1
• Calculated Molecular Weight: 23 kDa
• GenBank Accession Number: BC000866
• Gene Symbol: TIMP1
• Gene ID (NCBI): 7076
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01033
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.