TIMP1 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of HeLa using 83151-5-RR (same clone as 83151-5-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TIMP1 antibody (83151-5-RR, Clone: 230329E7 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 83151-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 83151-5-RR (same clone as 83151-5-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TIMP1 antibody (83151-5-RR, Clone: 230329E7 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 83151-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HT-29 using 83151-5-RR (same clone as 83151-5-PBS)

  1x10^6 HT-29 cells were intracellularly stained with 0.25 ug TIMP1 Recombinant antibody (83151-5-RR, Clone:230329E7) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83151-5-PBS in a different storage buffer formulation.

• 

  FC experiment of MDA-MB-231 using 83151-5-RR (same clone as 83151-5-PBS)

  1x10^6 MDA-MB-231 cells were intracellularly stained with 0.25 ug TIMP1 Recombinant antibody (83151-5-RR, Clone:230329E7) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83151-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83151-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83151-5-RR against Human TIMP1 were performed. The affinity constant is 1.33 nM.

TIMP1 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), ELISA

Cat No. 83151-5-PBS

Clone No.230329E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), ELISA

Synonyms

TIMP-1, 230329E7, CLGI, Collagenase inhibitor, EPA

---

Product Information

83151-5-PBS targets TIMP1 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0638

  Product name: Recombinant human TIMP1 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-207 aa of BC000866

  Sequence: CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

• Full Name: TIMP metallopeptidase inhibitor 1
• Calculated Molecular Weight: 23 kDa
• GenBank Accession Number: BC000866
• Gene Symbol: TIMP1
• Gene ID (NCBI): 7076
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P01033
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TIMP1 is a member of the family of matrix metalloproteinase inhibitors, which contains four members (TIMP1, TIMP2, TIMP3, and TIMP4). Tissue inhibitors of metalloproteinases (TIMPs) are multifaceted molecules that exhibit properties beyond their classical proteinase inhibitory function. TIMP1 has several MMP-independent functions such as modulation of angiogenesis, promotion of cell proliferation, and inhibition of apoptosis. TIMP1 plays important role in cell cycle regulation and cancer progression. Recently, clinical studies have shown that the aberrant expression of TIMP1 is associated with an unfavorable prognosis in a series of tumors, such as gastric cancer, papillary thyroid carcinoma, cutaneous melanoma and breast cancer. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium.