TJAP1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TJAP1 Recombinant monoclonal antibody (87106-3-RR)

• 

  WB analysis using 87106-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87106-3-RR (TJAP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 87106-3-RR

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using TJAP1 antibody (87106-3-RR, Clone: 252301G9 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity of 87106-3-RR

  Biolayer interferometry (BLl) kinetic assays of 87106-3-RR against Human TJAP1 were performed. The affinity constant is 29.2 nM.

TJAP1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87106-3-RR

Clone No.252301G9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

PILT, Tight junction-associated protein 1, TJAP 1, TJP4

---

Tested Applications

• Positive WB detected in: A431 cells, MDA-MB-231 cells, HSC-T6 cells, 4T1 cells
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87106-3-RR targets TJAP1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12174

  Product name: Recombinant human TJAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC064401

  Sequence: MTSAAPAKKPYRKAPPEHRELRLEIPGSRLEQEEPLTDAERMKLLQEENEELRRRLASATRRTEALERELEIGQDCLELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLIKKAEMDRKTLDWEIVELTNKLLDAKNTINKLEELNERYRLDCNLAVQLLKCNKSHFRNHKFADLPCELQDMVRKHLHSGQEAASPGPAPSLAPGAVVPTSVIARVLEKPESLLLNSAQSGSAGRPLAEDVFVHVDMSEGVPGDPASPPAPGSPTPQPNGECHSLGTARGSPEEELPLPAFEKLNPYPTPSPPHPLYPGRRVIEFSEDKVRIPRNSPLPNCTYATRQAISLS

• Full Name: tight junction associated protein 1 (peripheral)
• Calculated Molecular Weight: 547 aa, 61 kDa
• Observed Molecular Weight: 86-90 kDa
• GenBank Accession Number: BC064401
• Gene Symbol: TJAP1
• Gene ID (NCBI): 93643
• RRID: AB_3745343
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5JTD0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TJAP1, also named as PILT and TJP4, is colocalized at the tight junctions. TJAP1 has some forms with MW 60 kDa (native) and 86-90 kDa (modified).