TLE1 Monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 66216-1-Ig (same clone as 66216-1-PBS)

  WB result of TLE1 antibody (66216-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TLE1 transfected HEK-293 cells. This data was developed using the same antibody clone with 66216-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66216-1-Ig (same clone as 66216-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66216-1-Ig (TLE1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66216-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 66216-1-Ig (same clone as 66216-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66216-1-Ig (TLE1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66216-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 66216-1-Ig (same clone as 66216-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66216-1-Ig (TLE1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66216-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66216-1-Ig (same clone as 66216-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66216-1-Ig (TLE1 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66216-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 66216-1-Ig (same clone as 66216-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using TLE1 antibody (66216-1-Ig, Clone: 2F2H11 ) at dilution of 1:700 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66216-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TLE1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66216-1-PBS

Clone No.2F2H11

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Transducin-like enhancer protein 1, GRG1, Enhancer of split groucho-like protein 1, 2F2H11

---

Product Information

66216-1-PBS targets TLE1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21327

  Product name: Recombinant human TLE1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 422-770 aa of BC010100

  Sequence: DPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY

• Full Name: transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila)
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 85-95 kDa
• GenBank Accession Number: BC010100
• Gene Symbol: TLE1
• Gene ID (NCBI): 7088
• RRID: AB_2881607
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q04724
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TLE1 (Transducin-like enhancer protein 1) is a transcriptional corepressor and binds to a number of transcription factors. It can inhibit NF-kappa-B-regulated gene expression and the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES (PMID: 10660609). TLE1 is highly expressed in postnatal brain (PMID: 29758293; 27852056).