TLL1 Polyclonal antibody

• 

  WB analysis using 19160-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19160-1-AP (TLL1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

TLL1 Polyclonal Antibody for WB, ELISA

Cat No. 19160-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

TLL, TLL1, tolloid like 1, Tolloid like protein 1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, L02 cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19160-1-AP targets TLL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13639

  Product name: Recombinant human TLL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 25-350 aa of BC016922

  Sequence: LWVCAGLDYDYTFDGNEEDKTETIDYKDPCKAAVFWGDIALDDEDLNIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKRGALYQLIDRIRRIGFGLEQNNTVKGKVPLQFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACG

• Full Name: tolloid-like 1
• Calculated Molecular Weight: 115 kDa
• Observed Molecular Weight: 42-44 kDa
• GenBank Accession Number: BC016922
• Gene Symbol: TLL1
• Gene ID (NCBI): 7092
• RRID: AB_3085574
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43897
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TLL1 (Tolloid Like 1) is a Protein Coding gene. This gene encodes an astacin-like, zinc-dependent, metalloprotease that belongs to the peptidase M12A family. Diseases associated with TLL1 include Atrial Septal Defect 6 and Atrial Septal Defect, Ostium Primum Type. Among its related pathways are Collagen chain trimerization and Extracellular matrix organization. An important paralog of this gene is TLL2. TLL1 has 2 isoforms with the molecular mass of 115 and 44 kDa.