Anti-Human TLR3/CD283 Rabbit Recombinant Antibody

• 

  FC experiment of human monocyte-derived immature dendritic cells using 98016-2-RR

  1x10^6 human monocyte-derived immature dendritic cells were intracellularly stained with 0.25 ug Anti-Human TLR3/CD283 Rabbit Recombinant Antibody (98016-2-RR, Clone: 230445G9) or 0.25 ug Isotype Control and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Cells were then stained with APC Anti-Human CD11c. Cells were incubated with FC Receptor Block prior to fixing and staining. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of human monocyte-derived immature dendritic cells using 98016-2-RR

  1x10^6 human monocyte-derived immature dendritic cells were intracellularly stained with 0.25 ug Anti-Human TLR3/CD283 Rabbit Recombinant Antibody (98016-2-RR, Clone: 230445G9) (red) or 0.25 ug Isotype Control (blue) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Cells were then stained with APC Anti-Human CD11c. Cells were incubated with FC Receptor Block prior to fixing and staining. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 98016-2-RR

  Biolayer interferometry (BLl) kinetic assays of 98016-2-RR against Human TLR3/CD283 were performed. The affinity constant is below 1 pM.

TLR3/CD283 Recombinant Antibody for FC (Intra)

Cat No. 98016-2-RR

Clone No.230445G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

TLR3, Toll-like receptor 3, toll like receptor 3, CD283, 230445G9

---

Tested Applications

• Positive FC (Intra) detected in: human monocyte-derived immature dendritic cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98016-2-RR targets TLR3/CD283 in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34044

  Product name: Recombinant human TLR3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 725-904 aa of BC094737

  Sequence: FEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH

• Full Name: toll-like receptor 3
• Calculated Molecular Weight: 904 aa, 104 kDa
• GenBank Accession Number: BC094737
• Gene Symbol: TLR3
• Gene ID (NCBI): 7098
• RRID: AB_3672160
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O15455
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Stable for one year after shipment.

Background Information

TLR3 belongs to the Toll-like receptor family which is important in the innate immune response to pathogens. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. TLR3 is a nucleotide-sensing TLR that is activated by double-stranded RNA. Upon recognition of dsRNA, TLR3 transmits signals via the adaptor protein TICAM-1/TRIF, leading to the induction of type I IFN, cytokine/chemokine production, and dendritic cell (DC) maturation (PMID: 18262679).