CoraLite® Plus 750 Anti-Human TLR3/CD283 Rabbit Recombinant Antibody

TLR3/CD283 Recombinant Antibody for FC (Intra)
Cat No. CL750-98016-2
Clone No.230445G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

TLR3, Toll-like receptor 3, toll like receptor 3, CD283, 230445G9

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inhuman monocyte-derived immature dendritic cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-98016-2 targets TLR3/CD283 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34044

Product name: Recombinant human TLR3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 725-904 aa of BC094737

Sequence: FEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH

Predict reactive species
Full Name toll-like receptor 3
Calculated Molecular Weight 904 aa, 104 kDa
GenBank Accession NumberBC094737
Gene Symbol TLR3
Gene ID (NCBI) 7098
RRIDAB_3673785
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15455
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

TLR3 belongs to the Toll-like receptor family which is important in the innate immune response to pathogens. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. TLR3 is a nucleotide-sensing TLR that is activated by double-stranded RNA. Upon recognition of dsRNA, TLR3 transmits signals via the adaptor protein TICAM-1/TRIF, leading to the induction of type I IFN, cytokine/chemokine production, and dendritic cell (DC) maturation (PMID: 18262679).

Loading...
||
New chat Able
正在加载,请稍候...