TLR9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TLR9 Polyclonal antibody (27769-1-AP)

• 

  WB analysis using 27769-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27769-1-AP (TLR9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse brain using 27769-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TLR9 antibody (27769-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 27769-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TLR9 antibody (27769-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TLR9 Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 27769-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, ELISA

Synonyms

CD289, toll like receptor 9, Toll-like receptor 9, UNQ5798/PRO19605

---

Tested Applications

• Positive WB detected in: Daudi cells, Jurkat cells, Ramos cells, SH-SY5Y cells, mouse colon tissue, rat colon tissue
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27769-1-AP targets TLR9 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25615

  Product name: Recombinant human TLR9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 925-1032 aa of BC032713

  Sequence: ASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLEDRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHFYNRNFCQGPTAE

• Full Name: toll-like receptor 9
• Calculated Molecular Weight: 1032 aa, 116 kDa
• Observed Molecular Weight: 100-130 kDa, 60-80 kDa
• GenBank Accession Number: BC032713
• Gene Symbol: TLR9
• Gene ID (NCBI): 54106
• RRID: AB_3742257
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NR96
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TLR9 is a member of the Toll-like receptor family which has been described in a wide-variety of animal species. TLR9 recognizes DNA motifs containing the dinucleotide CG (cytosine-guanine) where the C is unmethylated (CpG-containing DNA). TLR9 is expressed in a wide variety of cells such as B-cells, eosinophils, neutrophils, dendritic cells, macrophages, bronchial epithelial cells, and type-I and type-II lung cells, amongst others. Like all TLRs that recognize nucleic acids, TLR9 is confined to the endoplasmic reticulum and to endolysosomes. Western blot analysis revealed a 130 kDa band (entire form). 100 kDa fragment (soluble form) and a supplementary 60~80 kDa band (cleaved fragment) (PMID: 24582318,18820679, 21604257).