TLX1 Polyclonal antibody

TLX1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26877-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Homeobox protein Hox 11, HOX11, Proto oncogene TCL 3, T cell leukemia homeobox 1, TCL3, TLX1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllWBIHC

WB analysis of NIH/3T3 using 26877-1-AP
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 26877-1-AP (TLX1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of NIH/3T3 using 26877-1-AP
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 26877-1-AP (TLX1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 26877-1-AP
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 26877-1-AP (TLX1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 26877-1-AP
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 26877-1-AP (TLX1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Positive WB detected in	NIH/3T3 cells
Positive IHC detected in	human lymphoma tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

26877-1-AP targets TLX1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag21899 Product name: Recombinant human TLX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 31-123 aa of BC130530 Sequence: GGCMGPASRLQDGEYGLGCLVGGAYTYGGGGSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSSGGA Predict reactive species
Full Name	T-cell leukemia homeobox 1
Calculated Molecular Weight	330 aa, 34 kDa
Observed Molecular Weight	34 kDa
GenBank Accession Number	BC130530
Gene Symbol	TLX1
Gene ID (NCBI)	3195
RRID	AB_2880666
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P31314
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Product Specific Protocols
IHC protocol for TLX1 antibody 26877-1-AP	Download protocol
WB protocol for TLX1 antibody 26877-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Species	Application	Title
human	IHC	Bioengineered Identification of key genes involved in the recurrence of glioblastoma multiforme using weighted gene co-expression network analysis and differential expression analysis Authors - Peng Ren View Article