TLX2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TLX2 Polyclonal antibody, PBS Only (27799-1-PBS)

• 

  WB analysis using 27799-1-AP (same clone as 27799-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27799-1-AP (TLX2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27799-1-PBS in a different storage buffer formulation.

TLX2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27799-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Homeobox protein Hox-11L1, HOX11L1, NCX, T-cell leukemia homeobox protein 2, TLX 2

---

Product Information

27799-1-PBS targets TLX2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24957

  Product name: Recombinant human TLX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-79 aa of BC006356

  Sequence: SGPETPGGGLGLGRGGQGHGENGAFSGGYHGASGYGPAGSLAPLPGSSGVGPGG

• Full Name: T-cell leukemia homeobox 2
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC006356
• Gene Symbol: TLX2
• Gene ID (NCBI): 3196
• RRID: AB_3742258
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43763
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TLX2 is an orphan homeodomain transcription factor whose expression is mainly associated with tissues derived from neural crest cells. PHOX2A and PHOX2B are able to enhance the neural cell-type specific expression of human TLX2 by binding distally the 5'-flanking region (PMID: 20044949).