TM6SF2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TM6SF2 Polyclonal antibody (27671-1-AP)

• 

  WB analysis using 27671-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27671-1-AP (TM6SF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 27671-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27671-1-AP (TM6SF2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 27671-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27671-1-AP (TM6SF2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TM6SF2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27671-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

KIAA1926, Transmembrane 6 superfamily member 2

---

Tested Applications

• Positive WB detected in: HepG2 cells, L02 cells, mouse liver tissue, rat liver tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27671-1-AP targets TM6SF2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26527

  Product name: Recombinant human TM6SF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 289-377 aa of NM_001001524

  Sequence: MFPGCSWLPDWALVFAGGIGQAQFSHMGASMHLRTPFTYRVPEDTWGCFFVCNLLYALGPHLLAYRCLQWPAFFHQPPPSDPLALHKKQH

• Full Name: transmembrane 6 superfamily member 2
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: NM_001001524
• Gene Symbol: TM6SF2
• Gene ID (NCBI): 53345
• RRID: AB_3085983
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZW4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TM6SF2 is mainly expressed in the liver, intestine, kidney, and in other tissues at low levels. In terms of subcellular localization, TM6SF2 is localized in the endoplasmic reticulum (ER), the ER-Golgi intermediate compartment, and Golgi of liver cells and enterocytes. The loss of TM6SF2 promotes the release of free fatty acids from IECs, leading to intestinal barrier dysfunction, gut microbiota dysbiosis and metabolite alterations (PMID: 29232562, 27013658). TM6SF2 encodes a protein predicted to have 7-10 transmembrane domains, containing 351 amino acids (39.5-kDa) with an estimated isoelectric point (pI) of 8.29 (PMID: 39779889).