TM7SF3 Polyclonal antibody

TM7SF3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 19826-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, HepG2 cells, mouse pancreas tissue, mouse testis tissue, U2OS cells
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU-251 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19826-1-AP targets TM7SF3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13919

Product name: Recombinant human TM7SF3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-295 aa of BC005176

Sequence: MGFLQLLVVAVLASEHRVAGAAEVFGNSSEGLIEFSVGKFRYFELNRPFPEEAILHDISSNVTFLIFQIHSQYQNTTVSFSPTLLSNSSETGTASGLVFILRPEQSTCTWYLGTSGIQPVQNMAILLSYSERDPVPGGCNLEFDLDIDPNIYLEYNFFETTIKFAPANLGYARGVDPPPCDAGTDQDSRWRLQYDVYQYFLPENDLTEEMLLKHLQRMVSVPQVKASALKVVTLTANDKTSVSFSSLPGQGVIYNVIVWDPFLNTSAAYIPAHTYACSFEAGEGSCASLGRVSSK

Predict reactive species
Full Name transmembrane 7 superfamily member 3
Calculated Molecular Weight 570 aa, 64 kDa
Observed Molecular Weight 64-80 kDa
GenBank Accession NumberBC005176
Gene Symbol TM7SF3
Gene ID (NCBI) 51768
RRIDAB_10638000
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NS93
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The seven-transmembrane superfamily member 3 protein (TM7SF3) is a pro-survival factor induced by p53 that regulates protein homeostasis and attenuates cellular stress. TM7SF3 inhibits caspase 3/7 while siRNA-mediated silencing of TM7SF3 accelerates ER stress and the unfolded protein responses (UPR). This involves inhibitory phosphorylation of eIF2α activity and increased expression of ATF3, ATF4, and C/EBP, followed by induction of apoptosis. TM7SF3 maintains cellular reducing power within physiological levels and reduces the content of proapoptotic proteins such as FAS, FADD, and caspase-8. (PMID: 36304109)

Protocols

Product Specific Protocols
IF protocol for TM7SF3 antibody 19826-1-APDownload protocol
IHC protocol for TM7SF3 antibody 19826-1-APDownload protocol
WB protocol for TM7SF3 antibody 19826-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...