TM7SF3 Polyclonal antibody

• 

  WB analysis using 19826-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19826-1-AP (TM7SF3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 19826-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19826-1-AP (TM7SF3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 19826-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 19826-1-AP (TM7SF3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 19826-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 19826-1-AP (TM7SF3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U-251 using 19826-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using TM7SF3 antibody (19826-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

TM7SF3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 19826-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, HepG2 cells, mouse pancreas tissue, mouse testis tissue, U2OS cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19826-1-AP targets TM7SF3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13919

  Product name: Recombinant human TM7SF3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-295 aa of BC005176

  Sequence: MGFLQLLVVAVLASEHRVAGAAEVFGNSSEGLIEFSVGKFRYFELNRPFPEEAILHDISSNVTFLIFQIHSQYQNTTVSFSPTLLSNSSETGTASGLVFILRPEQSTCTWYLGTSGIQPVQNMAILLSYSERDPVPGGCNLEFDLDIDPNIYLEYNFFETTIKFAPANLGYARGVDPPPCDAGTDQDSRWRLQYDVYQYFLPENDLTEEMLLKHLQRMVSVPQVKASALKVVTLTANDKTSVSFSSLPGQGVIYNVIVWDPFLNTSAAYIPAHTYACSFEAGEGSCASLGRVSSK

• Full Name: transmembrane 7 superfamily member 3
• Calculated Molecular Weight: 570 aa, 64 kDa
• Observed Molecular Weight: 64-80 kDa
• GenBank Accession Number: BC005176
• Gene Symbol: TM7SF3
• Gene ID (NCBI): 51768
• RRID: AB_10638000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NS93
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The seven-transmembrane superfamily member 3 protein (TM7SF3) is a pro-survival factor induced by p53 that regulates protein homeostasis and attenuates cellular stress. TM7SF3 inhibits caspase 3/7 while siRNA-mediated silencing of TM7SF3 accelerates ER stress and the unfolded protein responses (UPR). This involves inhibitory phosphorylation of eIF2α activity and increased expression of ATF3, ATF4, and C/EBP, followed by induction of apoptosis. TM7SF3 maintains cellular reducing power within physiological levels and reduces the content of proapoptotic proteins such as FAS, FADD, and caspase-8. (PMID: 36304109)