TM9SF1 Polyclonal antibody

• 

TM9SF1 Polyclonal Antibody for ELISA

Cat No. 16893-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

HMP70, MP70, MP70 protein family member, TM9SF1

---

Product Information

16893-1-AP targets TM9SF1 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10418

  Product name: Recombinant human TM9SF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-238 aa of BC010856

  Sequence: VEGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLS

• Full Name: transmembrane 9 superfamily member 1
• Calculated Molecular Weight: 606 aa, 69 kDa
• GenBank Accession Number: BC010856
• Gene Symbol: TM9SF1
• Gene ID (NCBI): 10548
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15321
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.