TM9SF1 Polyclonal antibody

• 

  IHC staining of mouse kidney using 16893-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16893-1-AP (TM9SF1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 16893-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16893-1-AP (TM9SF1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TM9SF1 Polyclonal Antibody for IHC, ELISA

Cat No. 16893-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

hMP70, MP70

---

Tested Applications

• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16893-1-AP targets TM9SF1 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10418

  Product name: Recombinant human TM9SF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-238 aa of BC010856

  Sequence: VEGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLS

• Full Name: transmembrane 9 superfamily member 1
• Calculated Molecular Weight: 606 aa, 69 kDa
• GenBank Accession Number: BC010856
• Gene Symbol: TM9SF1
• Gene ID (NCBI): 10548
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15321
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TM9SF1, also known as HMP70 and MP70, is a membrane protein that regulates cell autophagy (PMID: 19029833). TM9SF1 deficiency inhibits the maturation of antibody-secreting plasma cells through the activation of mTOR and inhibition of autophagy. TM9SF1 is associated with the activity of autoimmune diseases such as rheumatoid arthritis (RA) and systemic lupus erythematosus (SLE)(PMID: 39482663).