TMC2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMC2 Polyclonal antibody, PBS Only (27618-1-PBS)

• 

  IHC staining of mouse brain using 27618-1-AP (same clone as 27618-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27618-1-AP (TMC2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27618-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 27618-1-AP (same clone as 27618-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 27618-1-AP (TMC2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27618-1-PBS in a different storage buffer formulation.

TMC2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 27618-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

27618-1-PBS targets TMC2 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26366

  Product name: Recombinant human TMC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 805-906 aa of NM_080751

  Sequence: MSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRTTLPASGHLPISRPPGIGPDSGHAPSQTHPWRSASGKSAQRPPH

• Full Name: transmembrane channel-like 2
• Calculated Molecular Weight: 103 kDa
• GenBank Accession Number: NM_080751
• Gene Symbol: TMC2
• Gene ID (NCBI): 117532
• RRID: AB_3085977
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDI7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.