TMCO2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TMCO2 Polyclonal antibody (33338-1-AP)

• 

  WB analysis using 33338-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33338-1-AP (TMCO2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

TMCO2 Polyclonal Antibody for WB, ELISA

Cat No. 33338-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Transmembrane and coiled-coil domain-containing protein 2

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33338-1-AP targets TMCO2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37348

  Product name: Recombinant human TMCO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 72-182 aa of NM_001008740.3

  Sequence: KRSIQSIQKTLLFVITLYKLYKKGSHIFEALLANPEGSGLRIQDNNNLFLSLGLQEKILKKLKTVENKMKNLEGIIVAQKPATKRDCSSEPYCSCSDCQSPLSTSGFTSPI

• Full Name: transmembrane and coiled-coil domains 2
• Calculated Molecular Weight: 20kDa，182aa
• Observed Molecular Weight: 20-25 kDa
• GenBank Accession Number: NM_001008740.3
• Gene Symbol: TMCO2
• Gene ID (NCBI): 127391
• RRID: AB_3742945
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z6W1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.