TMED3 Polyclonal antibody

• 

  WB analysis using 21902-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21902-1-AP (TMED3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skin using 21902-1-AP

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 21902-1-AP (TMED3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 21902-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21902-1-AP (TMED3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-1080 using 21902-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 21902-1-AP (TMED3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 21902-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 21902-1-AP (TMED3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse small intestine using 21902-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 21902-1-AP (TMED3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 21902-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 21902-1-AP (TMED3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

TMED3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21902-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Transmembrane emp24 domain-containing protein 3, p26, p24gamma4, p24 family protein gamma-4, Membrane protein p24B

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, mouse small intestine tissue, mouse skin tissue, HT-1080 cells, HepG2 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 6 publications below

Product Information

21902-1-AP targets TMED3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14032

  Product name: Recombinant human TMED3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-201 aa of BC000027

  Sequence: MGSTVPRSASVLLLLLLLRRAEQPCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLL

• Full Name: transmembrane emp24 protein transport domain containing 3
• Calculated Molecular Weight: 217 aa, 25 kDa
• Observed Molecular Weight: 21-25 kDa
• GenBank Accession Number: BC000027
• Gene Symbol: TMED3
• Gene ID (NCBI): 23423
• RRID: AB_10897159
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3Q3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Clin Invest; Chromosomal 3q amplicon encodes essential regulators of secretory vesicles that drive secretory addiction in cancer; Authors - Xiaochao Tan
human	WB	J Biol Chem; Down-regulation of the islet-specific zinc transporter-8 (ZnT8) protects human insulinoma cells against inflammatory stress.; Authors - Chengfeng Merriman
human	WB	Toxicol Appl Pharmacol; TMED3 exerts a protumor function in non-small cell lung cancer by enhancing the Wnt/β-catenin pathway via regulation of AKT.; Authors - Danjie Zhang ; KD Validated
human	WB	Onco Targets Ther; TMED3 Promotes Proliferation and Migration in Breast Cancer Cells by Activating Wnt/β-Catenin Signaling.; Authors - Xiumei Zhang ; KD Validated
human	WB	Ann Transl Med; Screening of the novel immune-suppressive biomarkers of TMED family and whether knockdown of TMED2/3/4/9 inhibits cell migration and invasion in breast cancer; Authors - Zheng Fang ; KD Validated
human	WB	J Cancer Res Clin Oncol; Analysis and Validation of TMED3 correlates with poor prognosis and tumor immune infiltration of glioma; Authors - Gang Liao