TMED9 Monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMED9 Monoclonal antibody, PBS Only (60631-7-PBS)

TMED9 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 60631-7-PBS

Clone No.3E10H6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Glycoprotein 25L2, GMP25, GP25L2, p24 family protein alpha-2, p24alpha2

• 

  WB analysis using 60631-7-Ig (same clone as 60631-7-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60631-7-Ig (TMED9 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60631-7-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 60631-7-Ig (same clone as 60631-7-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 60631-7-Ig (TMED9 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60631-7-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

60631-7-PBS targets TMED9 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13754

  Product name: Recombinant human TMED9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-224 aa of BC001123

  Sequence: MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRH

• Full Name: transmembrane emp24 protein transport domain containing 9
• Calculated Molecular Weight: 235 aa, 27 kDa
• Observed Molecular Weight: 24-27 kDa
• GenBank Accession Number: BC001123
• Gene Symbol: TMED9
• Gene ID (NCBI): 54732
• RRID: AB_3743225
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BVK6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMED9 (also named as GMP25, GP25L2, or p25) is a member of the EMP24/GP25L family. TMED9 probably forms hetero-oligomeric complexes with TMED7 (p27), TMED2 (p24), and TMED10 (p23) (PMID: 10359607). Located in the endoplasmic reticulum and the Golgi, TMED9 appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway (PMID: 9472029; 10359607).