TMED9 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TMED9 Recombinant monoclonal antibody (86802-1-RR)

TMED9 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86802-1-RR

Clone No.251396A1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Glycoprotein 25L2, GMP25, GP25L2, p24 family protein alpha-2, p24alpha2

• 

  WB analysis using 86802-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86802-1-RR (TMED9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 86802-1-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using TMED9 antibody (86802-1-RR, Clone: 251396A1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 86802-1-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using TMED9 antibody (86802-1-RR, Clone: 251396A1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: PC-12 cells, MCF-7 cells, OVCAR-3 cells, A2780 cells, HepG2 cells, NIH/3T3 cells
• Positive IF/ICC detected in: A549 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86802-1-RR targets TMED9 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13813

  Product name: Recombinant human TMED9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-224 aa of BC001123

  Sequence: MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRH

• Full Name: transmembrane emp24 protein transport domain containing 9
• Calculated Molecular Weight: 235 aa, 27 kDa
• Observed Molecular Weight: 24-27 kDa
• GenBank Accession Number: BC001123
• Gene Symbol: TMED9
• Gene ID (NCBI): 54732
• RRID: AB_3745128
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BVK6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMED9 (also named as GMP25, GP25L2 or p25) is a member of the EMP24/GP25L family. TMED9 probably forms hetero-oligomeric complexes with TMED7 (p27), TMED2 (p24), and TMED10 (p23) (PMID: 10359607). Located in the endoplasmic reticulum and the Golgi, TMED9 appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway (PMID: 9472029; 10359607).