TMEM106B Monoclonal antibody, PBS Only (Detector)

TMEM106B Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 60333-6-PBS
Clone No.3A3H6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Transmembrane protein 106B

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60333-6-PBS targets TMEM106B as part of a matched antibody pair:

MP50326-3: 60333-2-PBS capture and 60333-6-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21448

Product name: Recombinant human TMEM106B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-46 aa of BC033901

Sequence: MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVS

Predict reactive species
Full Name transmembrane protein 106B
Calculated Molecular Weight 31 kDa
GenBank Accession NumberBC033901
Gene Symbol TMEM106B
Gene ID (NCBI) 54664
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NUM4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...