TMEM106B Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse brain using 84196-3-RR (same clone as 84196-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84196-3-RR (TMEM106B antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84196-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84196-3-RR (same clone as 84196-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84196-3-RR (TMEM106B antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84196-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 84196-3-RR (same clone as 84196-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 84196-3-RR (TMEM106B antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84196-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 84196-3-RR (same clone as 84196-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 84196-3-RR (TMEM106B antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84196-3-PBS in a different storage buffer formulation.

TMEM106B Uni-rAb^® Recombinant Antibody for IHC, Indirect ELISA

Cat No. 84196-3-PBS

Clone No.250288B6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

Transmembrane protein 106B

---

Product Information

84196-3-PBS targets TMEM106B in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4518

  Product name: recombinant human TMEM106B protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 119-274 aa of BC033901

  Sequence: RSIDVKYIGVKSAYVSYDVQKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ

• Full Name: transmembrane protein 106B
• Calculated Molecular Weight: 31 kDa
• GenBank Accession Number: BC033901
• Gene Symbol: TMEM106B
• Gene ID (NCBI): 54664
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NUM4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM106B is a genetic risk factor for frontotemporal lobar degeneration with TDP-43 inclusions (FTLD-TDP). Amyotrophic lateral sclerosis (ALS), like FTLD-TDP, is characterized by pathological TDP-43 inclusions. TMEM106B expression in the brain may be linked to mechanisms of disease in FTLD-TDP and risk alleles confer genetic susceptibility by increasing gene expression. TMEM106B can be showed as 31-55 kDa and 70-90 kDa (Glycosylated or Dimer) form in western blot test. (PMID: 27543298, 22895706, PMID: 23136129).