TMEM11 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TMEM11 Polyclonal antibody (16564-1-AP)

• Featured Product
• KD/KO Validated

TMEM11 Polyclonal Antibody for WB, ELISA

Cat No. 16564-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

C17orf35, PM1, PMI, Protein PM1, TMEM11, transmembrane protein 11

• 

  WB analysis of human placenta using 16564-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 16564-1-AP (TMEM11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse placenta using 16564-1-AP

  mouse placenta tissue were subjected to SDS PAGE followed by western blot with 16564-1-AP (TMEM11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 16564-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 16564-1-AP (TMEM11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TMEM11 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human placenta tissue, mouse placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16564-1-AP targets TMEM11 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9839

  Product name: Recombinant human TMEM11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-175 aa of BC020815

  Sequence: MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIA

• Full Name: transmembrane protein 11
• Calculated Molecular Weight: 192 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC020815
• Gene Symbol: TMEM11
• Gene ID (NCBI): 8834
• RRID: AB_2287468
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17152
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM11, also named as C17orf35 and PM1, belongs to the TMEM11 family. TMEM11 is a mitochondrial inner-membrane protein facing the matrix. It regulates mitochondrial morphogenesis independently of the DRP1/MFN fission/fusion pathways.(PMID:21274005)

Publications

What published studies show

The TMEM11 Polyclonal antibody (Cat# 16564-1-AP) has 5 citations published in Science Advances, Cell Reports, Journal of Cell Biology, EMBO Reports, and eLife. The associated research fields center on mitochondrial biology, including mitochondrial distribution and dynamics, mitochondrial reactive oxygen species regulation of metabolism, spatially restricted mitophagy, mitochondrial morphogenesis independent of DRP1/MFN pathways, and MICOS complex stability with cristae morphology.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Sci Adv; ARMC1 partitions between distinct complexes and assembles MIRO with MTFR to control mitochondrial distribution; Authors - Michael J McKenna
mouse	WB	Cell Rep; Mitochondrial reactive oxygen species regulate acetyl-CoA flux between cytokine production and fatty acid synthesis in effector T cells; Authors - Beibei Wu
human	WB	J Cell Biol; The outer mitochondrial membrane protein TMEM11 demarcates spatially restricted BNIP3/BNIP3L-mediated mitophagy; Authors - Mehmet Oguz Gok
human	WB	EMBO Rep; Inner-membrane proteins PMI/TMEM11 regulate mitochondrial morphogenesis independently of the DRP1/MFN fission/fusion pathways.; Authors - Rival Thomas T ; KD Validated
human	WB	Elife; QIL1 is a novel mitochondrial protein required for MICOS complex stability and cristae morphology.; Authors - Virginia Guarani