TMEM115 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM115 Polyclonal antibody, PBS Only (25536-1-PBS)

• 

  WB analysis of U2OS using 25536-1-AP (same clone as 25536-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 25536-1-AP (TMEM115 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25536-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25536-1-AP (same clone as 25536-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25536-1-AP (TMEM115 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25536-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 25536-1-AP (same clone as 25536-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 25536-1-AP (TMEM115 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25536-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 25536-1-AP (same clone as 25536-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 25536-1-AP (TMEM115 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25536-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 25536-1-AP (same clone as 25536-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 25536-1-AP (TMEM115 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25536-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 25536-1-AP (same clone as 25536-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 25536-1-AP (TMEM115 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25536-1-PBS in a different storage buffer formulation.

TMEM115 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25536-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Transmembrane protein 115, Placental protein 6, PL6, LUCA11.2

---

Product Information

25536-1-PBS targets TMEM115 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22258

  Product name: Recombinant human TMEM115 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 233-351 aa of BC017367

  Sequence: QPVVGLLANLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPTL

• Full Name: transmembrane protein 115
• Calculated Molecular Weight: 351 aa, 38 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC017367
• Gene Symbol: TMEM115
• Gene ID (NCBI): 11070
• RRID: AB_3669482
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12893
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM115 also known as PL6, located on chromosome 3p21.3, was originally thought to function as a tumor suppressor. TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport.