• Featured Product
  • KD/KO Validated

TMEM126A Recombinant monoclonal antibody, PBS Only (Capture)

TMEM126A Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 83440-2-PBS
Clone No.240425A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

240425A11, OPA7, TMEM, TMEM126

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83440-2-PBS targets TMEM126A as part of a matched antibody pair:

MP00449-1: 83440-2-PBS capture and 83440-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14705

Product name: Recombinant human TMEM126A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 67-195 aa of BC007875

Sequence: AGLPMAGIPFLTTDLTYRCFVSFPLNTGDLDCETCTITRSGLTGLVIGGLYPVFLAIPVNGGLAARYQSALLPHKGNILSYWIRTSKPVFRKMLFPILLQTMFSAYLGSEQYKLLIKALQLSEPGKEIH

Predict reactive species
Full Name transmembrane protein 126A
Calculated Molecular Weight 195 aa, 22 kDa
Observed Molecular Weight20-25 kDa
GenBank Accession NumberBC007875
Gene Symbol TMEM126A
Gene ID (NCBI) 84233
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H061
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TMEM126A is a mitochondrial inner membrane protein that is enriched in the cristae. TMEM126A is necessary for Complex I assembly or stability.Complex I (CI) is the largest enzyme of the mitochondrial respiratory chain, and its defects are the main cause of mitochondrial disease.

Loading...
||
New chat Able
正在加载,请稍候...