TMEM134 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TMEM134 Polyclonal antibody (25078-1-AP)

• 

  WB analysis of rat spleen using 25078-1-AP

  rat spleen tissue were subjected to SDS PAGE followed by western blot with 25078-1-AP (TMEM134 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25078-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25078-1-AP (TMEM134 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of PC-3 using 25078-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using TMEM134 antibody (25078-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

TMEM134 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25078-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, ELISA

Synonyms

transmembrane protein 134

---

Tested Applications

• Positive WB detected in: rat spleen tissue, mouse spleen tissue
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25078-1-AP targets TMEM134 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18533

  Product name: Recombinant human TMEM134 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-124 aa of BC125134

  Sequence: QFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVV

• Full Name: transmembrane protein 134
• Calculated Molecular Weight: 180 aa, 20 kDa
• Observed Molecular Weight: 22-27 kDa
• GenBank Accession Number: BC125134
• Gene Symbol: TMEM134
• Gene ID (NCBI): 80194
• RRID: AB_3669461
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6X4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transmembrane protein 134 is a protein encoded by the TMEM134 gene. TMEM134 is regulated by the promoter GXP50275. TMEM134 is ubiquitously expressed in the majority of human tissues.