Product Information
26642-1-PBS targets TMEM138 in IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24487 Product name: Recombinant human TMEM138 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 101-162 aa of BC005201 Sequence: NLRWKNSNSFIWTDGLQMLFVFQRLAAVLYCYFYKRTAVRLGDPHFYQDSLWLRKEFMQVRR Predict reactive species |
| Full Name | transmembrane protein 138 |
| Calculated Molecular Weight | 162 aa, 19 kDa |
| GenBank Accession Number | BC005201 |
| Gene Symbol | TMEM138 |
| Gene ID (NCBI) | 51524 |
| RRID | AB_3742197 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NPI0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. |
Background Information
The TMEM138 gene encodes a protein with multiple transmembrane domains that is expressed in various tissues and involved in regulating biological processes. While its exact cellular localization and function are not fully understood, studies suggest it may impact neural development and disease occurrence by influencing intracellular signal transduction pathways, cytoskeleton dynamics, and membrane protein transport mechanisms. Tmem138 and Tmem216 are arranged in a head-to-tail configuration on human chromosome 11 and mouse chromosome 19, sharing intergenic regulatory elements . Tmem138 is localized at the ciliary base and axoneme, while Tmem216 is primarily in the BBs in IMCD3 cells . (PMID: 35394880,PMID: 40432436)

