TMEM141 Polyclonal antibody

• 

  WB analysis of HeLa using 16092-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16092-1-AP (TMEM141 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 16092-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 16092-1-AP (TMEM141 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 16092-1-AP

  Immunofluorescent analysis of HeLa cells using 16092-1-AP (TMEM141 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

TMEM141 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 16092-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

RP11 216L13.7, TMEM141, transmembrane protein 141

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

16092-1-AP targets TMEM141 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8341

  Product name: Recombinant human TMEM141 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-108 aa of BC007834

  Sequence: MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS

• Full Name: transmembrane protein 141
• Calculated Molecular Weight: 108 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC007834
• Gene Symbol: TMEM141
• Gene ID (NCBI): 85014
• RRID: AB_10858323
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96I45
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IF	Front Med; Panoramic variation analysis of a family with neurodevelopmental disorders caused by biallelic loss-of-function variants in TMEM141, DDHD2, and LHFPL5; Authors - Liwei Sun