Filter: AllWBIP

WB analysis using 33601-1-AP (same clone as 33601-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 33601-1-AP (TMEM155 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33601-1-PBS in a different storage buffer formulation.
IP experiment of mouse brain using 33601-1-AP (same clone as 33601-1-PBS)
IP result of anti-TMEM155 (IP:33601-1-AP, 4 ug; Detection:33601-1-AP 1:500) with mouse brain tissue lysate 1720 ug. This data was developed using the same antibody clone with 33601-1-PBS in a different storage buffer formulation.
IP experiment of pig brain using 33601-1-AP (same clone as 33601-1-PBS)
IP result of anti-TMEM155 (IP:33601-1-AP, 4 ug; Detection:33601-1-AP 1:500) with pig brain tissue lysate 1240 ug. This data was developed using the same antibody clone with 33601-1-PBS in a different storage buffer formulation.

TMEM155 Polyclonal antibody, PBS Only

Name: TMEM155 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 33601-1-PBS

TMEM155 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 33601-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IP, Indirect ELISA

Synonyms

NEMEP, Nodal enhanced mesendoderm micropeptide, Small integral membrane protein 43, SMIM43

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

33601-1-PBS targets TMEM155 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity	human, mouse, rat, pig
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag39858 Product name: Recombinant human TMEM155 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-63 aa of NM_001384332.1 Sequence: MEWELNLLLYLALFFFLLFLLFLLLFVVIKQLKNSVANTAGALQPGRLSVHREPWGFSREQAV Predict reactive species
Full Name	transmembrane protein 155
Calculated Molecular Weight	7 kDa，63aa
Observed Molecular Weight	10-15 kDa
GenBank Accession Number	NM_001384332.1
Gene Symbol	TMEM155
Gene ID (NCBI)	132332
RRID	AB_3743026
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity Purification
UNIPROT ID	Q4W5P6
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™