TMEM160 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM160 Polyclonal antibody, PBS Only (26451-1-PBS)

• 

  WB analysis using 26451-1-AP (same clone as 26451-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26451-1-AP (TMEM160 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26451-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 26451-1-AP (same clone as 26451-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 26451-1-AP (TMEM160 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26451-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 26451-1-AP (same clone as 26451-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 26451-1-AP (TMEM160 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26451-1-PBS in a different storage buffer formulation.

TMEM160 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26451-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

26451-1-PBS targets TMEM160 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24915

  Product name: Recombinant human TMEM160 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-68 aa of BC002907

  Sequence: MGGGWWWARAARLARLRFRRSLLPPQRPRSGGARGSFAPGHGPRAGASPPPVSELDRADAWLLRKAHE

• Full Name: transmembrane protein 160
• Calculated Molecular Weight: 188 aa, 20 kDa
• Observed Molecular Weight: 15-20 kDa
• GenBank Accession Number: BC002907
• Gene Symbol: TMEM160
• Gene ID (NCBI): 54958
• RRID: AB_3669535
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NX00
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The transmembrane protein (TMEM) family encompasses transmembrane proteins that traverse the lipid bilayer and wield critical functions across various cell types, encompassing inflammation and store-operated Ca2+ entry. TMEM160, a identified transmembrane protein that is localized in the mitochondrial membrane, has been implicated in neuropathic pain.