TMEM164 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TMEM164 Polyclonal antibody (31625-1-AP)

• 

  IHC staining of mouse skeletal muscle using 31625-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 31625-1-AP (TMEM164 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 31625-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 31625-1-AP (TMEM164 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 31625-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using TMEM164 antibody (31625-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

TMEM164 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 31625-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

bB360B22.3, transmembrane protein 164

---

Tested Applications

• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31625-1-AP targets TMEM164 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34317

  Product name: Recombinant human TMEM164 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-38 aa of BC085605

  Sequence: MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQR

• Full Name: transmembrane protein 164
• GenBank Accession Number: BC085605
• Gene Symbol: TMEM164
• Gene ID (NCBI): 84187
• RRID: AB_3742456
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5U3C3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM164 (Transmembrane Protein 164) is a membrane protein with significant roles in various biological processes, including lipid metabolism, neuroprotection, and cancer regulation. In non-small cell lung cancer (NSCLC), TMEM164 promotes ferroptosis by mediating autophagy, leading to the degradation of ferritin, GPX4, and lipid droplets, which facilitates iron accumulation and lipid peroxidation (PMID: 39798196). In neurodegenerative diseases, TMEM164 overexpression via gene therapy shows promise in reducing neurotoxic reactive astrocyte activation and alleviating disease symptoms (PMID: 37679556).