TMEM174 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM174 Polyclonal antibody, PBS Only (31210-1-PBS)

• 

  WB analysis using 31210-1-AP (same clone as 31210-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31210-1-AP (TMEM174 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31210-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293T using 31210-1-AP (same clone as 31210-1-PBS)

  WB result of TMEM174 antibody (31210-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TMEM174 transfected HEK-293T cells. This data was developed using the same antibody clone with 31210-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 31210-1-AP (same clone as 31210-1-PBS)

  IP result of anti-TMEM174 (IP:31210-1-AP, 4ug; Detection:31210-1-AP 1:800) with Jurkat cells lysate 1360 ug. This data was developed using the same antibody clone with 31210-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TMEM174 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 31210-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

transmembrane protein 174

---

Product Information

31210-1-PBS targets TMEM174 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35041

  Product name: Recombinant human TMEM174 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-243 aa of BC019346

  Sequence: MEQGSGRLEDFPVNVFSVTPYTPSTADIQVSDDDKAGATLLFSGIFLGLVGITFTVMGWIKYQGVSHFEWTQLLGPVLLSVGVTFILIAVCKFKMLSCQLCKESEERVPDSEQTPGGPSFVFTGINQPITFHGATVVQYIPPPYGSPEPMGINTSYLQSVVSPCGLITSGGAAAAMSSPPQYYTIYPQDNSAFVVDEGCLSFTDGGNHRPNPDVDQLEETQLEEEACACFSPPPYEEIYSLPR

• Full Name: transmembrane protein 174
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC019346
• Gene Symbol: TMEM174
• Gene ID (NCBI): 134288
• RRID: AB_3742409
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8WUU8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transmembrane protein 174 (TMEM174) is comprised of 243 amino acids, and contains two predicted transmembrane helices which determine its subcellular localization in endoplasmic reticulum and influences its functions (PMID: 20331980). TMEM174) mRNA is easily detectable in human kidney tissues and activates AP-1 and promotes 293T cell proliferation (PMID: 25202393). The Tmem174 protein was extremely highly expressed in the kidney and localized at the apical membrane of the renal proximal tubules. Tmem174 binds to NaPi2a on the cell membrane and is involved in the internalization of NaPi2a (PMID: 35428804). Tmem174 is considered to be a component of the NaPi2a/NHERF1 complex that receives signals from PTH and FGF23 (PMID: 35428804). This antibody may recognize the dimer.