TMEM176A Polyclonal antibody

• 

  WB analysis of fetal human brain using 20378-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 20378-1-AP (TMEM176A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 20378-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20378-1-AP (TMEM176A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 20378-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20378-1-AP (TMEM176A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 20378-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 20378-1-AP (TMEM176A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 20378-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 20378-1-AP (TMEM176A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 20378-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using TMEM176A antibody (20378-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

TMEM176A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20378-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

GS188, HCA112, Hepatocellular carcinoma-associated antigen 112, Transmembrane protein 176A

---

Tested Applications

• Positive WB detected in: fetal human brain tissue
• Positive IHC detected in: mouse brain tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20378-1-AP targets TMEM176A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14194

  Product name: Recombinant human TMEM176A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 123-203 aa of BC008303

  Sequence: LAAFSTAIAALKLWNEDFRYGYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQAMLLGVWILLL

• Full Name: transmembrane protein 176A
• Calculated Molecular Weight: 235 aa, 26 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC008303
• Gene Symbol: TMEM176A
• Gene ID (NCBI): 55365
• RRID: AB_10697661
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96HP8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.