Product Information
31293-1-PBS targets TMEM189 in IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34323 Product name: Recombinant human TMEM189 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 182-270 aa of BC142966 Sequence: TNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK Predict reactive species |
| Full Name | transmembrane protein 189 |
| Observed Molecular Weight | 31 kDa |
| GenBank Accession Number | BC142966 |
| Gene Symbol | TMEM189 |
| Gene ID (NCBI) | 387521 |
| RRID | AB_3742416 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | A5PLL7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TMEM189 (Plasmanylethanolamine desaturase 1), also known as PEDS1. It is predicted to be located in the endoplasmic reticulum membrane. Plasmalogens are glycerophospholipids with a hydrocarbon chain linked by a vinyl ether bond at the glycerol sn-1 position, and are involved in antioxidative and signaling mechanisms (PMID: 31604315). The molecular weight of TMEM189 is 31 kDa.



