TMEM204 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM204 Polyclonal antibody, PBS Only (20479-1-PBS)

• 

  WB analysis using 20479-1-AP (same clone as 20479-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20479-1-AP (TMEM204 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20479-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse kidney using 20479-1-AP (same clone as 20479-1-PBS)

  IP result of anti-TMEM204 (IP:20479-1-AP, 4ug; Detection:20479-1-AP 1:800) with mouse kidney tissue lysate 3400 ug. This data was developed using the same antibody clone with 20479-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 20479-1-AP (same clone as 20479-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 20479-1-AP (TMEM204 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20479-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 20479-1-AP (same clone as 20479-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 20479-1-AP (TMEM204 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20479-1-PBS in a different storage buffer formulation.

TMEM204 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 20479-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

C16orf30, Claudin like protein 24, CLP24, transmembrane protein 204

---

Product Information

20479-1-PBS targets TMEM204 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14353

  Product name: Recombinant human TMEM204 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 16-114 aa of BC004932

  Sequence: VSLILNNVAAFTSNWVCQTLEDGRRRSVGLWRSCWLVDRTRGGPSPGARAGQVDAHDCEALGWGSEAAGFQESRGTVKLQFDMMRACNLVATAALTAGQ

• Full Name: transmembrane protein 204
• Calculated Molecular Weight: 226 aa, 25 kDa
• Observed Molecular Weight: 24-30 kDa
• GenBank Accession Number: BC004932
• Gene Symbol: TMEM204
• Gene ID (NCBI): 79652
• RRID: AB_3741997
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BSN7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.