TMEM205 Polyclonal antibody

• 

  WB analysis using 32273-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32273-1-AP (TMEM205 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

TMEM205 Polyclonal Antibody for WB, ELISA

Cat No. 32273-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

Transmembrane protein 205, UNQ501/PRO1018

---

Tested Applications

• Positive WB detected in: HT-1376 cells, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32273-1-AP targets TMEM205 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15211

  Product name: Recombinant human TMEM205 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-189 aa of BC064948

  Sequence: TVNARWLEPRTTAAMWALQTVEKERGLGGEVPGSHQGPDPYRQLREKDPKYSALRQNFFRYHGLSSLCNLGCVLSNGLCLAGLALEIRSL

• Full Name: transmembrane protein 205
• Calculated Molecular Weight: 189 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC064948
• Gene Symbol: TMEM205
• Gene ID (NCBI): 374882
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6UW68
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

As a member of the transmembrane proteins (TMEMs), TMEM205 constructed transmembrane channels for a variety of substances, mediating communication between the intracellular and extracellular environment (PMID: 38850316).