TMEM208 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TMEM208 Polyclonal antibody (31728-1-AP)

• 

  WB analysis using 31728-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31728-1-AP (TMEM208 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse stomach using 31728-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 31728-1-AP (TMEM208 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse stomach using 31728-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 31728-1-AP (TMEM208 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TMEM208 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 31728-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

HSND2, HSPC171, SND2, Transmembrane protein 208

---

Tested Applications

• Positive WB detected in: 37°C incubated mouse brain tissue, 37°C incubated rat brain tissue
• Positive IHC detected in: mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31728-1-AP targets TMEM208 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35668

  Product name: Recombinant human TMEM208 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 130-173 aa of BC003080

  Sequence: PGRALYLLWVNVLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL

• Full Name: transmembrane protein 208
• Calculated Molecular Weight: 173 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC003080
• Gene Symbol: TMEM208
• Gene ID (NCBI): 29100
• RRID: AB_3742465
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BTX3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transmembrane protein 208 (TMEM208) can regulate both autophagy and ER stress. When overexpressed, TMEM208 impaired autophagy as characterized by the decrease of the accumulation of LC3-II, decreased degradation of autophagic substrates, and reduced expression of critical effectors and vital molecules of the ER stress and autophagy processes. (PMID: 23691174)