TMEM209 Polyclonal antibody

• 

  WB analysis using 33203-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33203-1-AP (TMEM209 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

TMEM209 Polyclonal Antibody for WB, ELISA

Cat No. 33203-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Transmembrane protein 209

---

Tested Applications

• Positive WB detected in: A431 cells, Jurkat cells, human testis tissue, mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33203-1-AP targets TMEM209 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34162

  Product name: Recombinant human TMEM209 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 210-362 aa of BC045618

  Sequence: VESSGLRSRYRSSPTVYNSPTDKEDYMTDLRTLDTFLRSEEEKQHRVKLGSPDSTSPSSSPTFWNYSRSMGDYAQTLKKFQYQLACRSQAPCANKDEADLSSKQAAEEVWARVAMNRQLLDHMDSWTAKFRNWINETILVPLVQEIESVSTQM

• Full Name: transmembrane protein 209
• Calculated Molecular Weight: 561 aa, 63 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC045618
• Gene Symbol: TMEM209
• Gene ID (NCBI): 84928
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96SK2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transmembrane protein 209 (TMEM209) is a nuclear envelope protein that interacts with nucleoporin protein NUP205, and may be involved in nuclear transport of various nuclear proteins in addition to MYC (PMID: 22719065). Additionally, TMEM209 is implicated in the regulation of the Wnt/β-catenin signaling pathway, which is often activated in hepatocellular carcinoma (HCC) and contributes to tumor progression (PMID: 39414762).