TMEM258 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TMEM258 Polyclonal antibody (31525-1-AP)

• 

  WB analysis using 31525-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31525-1-AP (TMEM258 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse small intestine using 31525-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 31525-1-AP (TMEM258 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 31525-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 31525-1-AP (TMEM258 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 31525-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 31525-1-AP (TMEM258 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TMEM258 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 31525-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

C11orf10

---

Tested Applications

• Positive WB detected in: HepG2 cells, PC-3 cells, SH-SY5Y cells, U2OS cells
• Positive IHC detected in: mouse kidney tissue, mouse small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31525-1-AP targets TMEM258 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35142

  Product name: Recombinant human TMEM258 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-54 aa of BC015968

  Sequence: MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKEL

• Full Name: chromosome 11 open reading frame 10
• Observed Molecular Weight: 10 and 16 kDa
• GenBank Accession Number: BC015968
• Gene Symbol: C11orf10
• Gene ID (NCBI): 746
• RRID: AB_3742445
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P61165
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM258, or transmembrane protein 258, is a component of the oligosaccharyltransferase (OST) complex. Research has shown that TMEM258 is involved in controlling ER stress and intestinal inflammation. In particular, it has been identified as a central regulator of intestinal homeostasis. The loss of TMEM258 leads to unresolved ER stress, which can result in apoptosis (PMID: 27974209). The calculated MW is 9 kDa, The observed MW is multiple bands, which may be caused by Glycosylation modification.