TMEM26 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM26 Polyclonal antibody, PBS Only (27267-1-PBS)

• 

  WB analysis using 27267-1-AP (same clone as 27267-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27267-1-AP (TMEM26 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27267-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27267-1-AP (same clone as 27267-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27267-1-AP (TMEM26 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27267-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 27267-1-AP (same clone as 27267-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27267-1-AP (TMEM26 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27267-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 27267-1-AP (same clone as 27267-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27267-1-AP (TMEM26 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27267-1-PBS in a different storage buffer formulation.

TMEM26 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27267-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

transmembrane protein 26

---

Product Information

27267-1-PBS targets TMEM26 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24409

  Product name: Recombinant human TMEM26 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 84-188 aa of BC042872

  Sequence: ELHHETQYCSIQAEGTSQNTSRKEDFNQTLTSNEQTSRADDLIETAKVFVNNLSTVCEKVWTLGLHQTFLLMLIIGRWLLPIGGGITRDQLSQLLLMFVGTAADI

• Full Name: transmembrane protein 26
• Calculated Molecular Weight: 368 aa, 42 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC042872
• Gene Symbol: TMEM26
• Gene ID (NCBI): 219623
• RRID: AB_3742226
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZUK4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The Transmembrane protein 26 (TMEM26) gene encodes a protein containing multiple transmembrane fragments. Immunostaining indicated elevated TMEM26 expression in ESCC tumors. Various ESCC cell lines showed a high TMEM26 expression, where its plasma membrane localization was confirmed. The RNAi depletion of TMEM26 in TMEM26-high ESCC cells suppressed EMT-related alterations, including invasion, migration, and marker gene expression. Conversely, TMEM26 overexpression in TMEM26-low ESCC cells promoted these EMT-related alterations. Interestingly, TMEM26 depletion or overexpression did not affect cell growth, indicating its specific involvement in the EMT process. The animal study demonstrated the contributive role of TMEM26 in metastatic ESCC. Mechanistically, TMEM26 promoted NF-κB signaling to accelerate EMT in ESCC cells. The plasma membrane presentation and TJ protein assembly were impaired by TMEM26, which was likely to be another mechanism for EMT regulation by TMEM26 in ESCC. Therefore, TMEM26 disrupted TJ formation and promoted NF-κB signaling during the EMT activation in ESCC (PMID: 37611445). TMEM26 shows features for chain, glycosylation, modified residue (large scale data).