TMEM260 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TMEM260 Polyclonal antibody (33682-1-AP)

• 

  WB analysis using 33682-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33682-1-AP (TMEM260 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

TMEM260 Polyclonal Antibody for WB, ELISA

Cat No. 33682-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C14orf101, EC:2.4.1.109, Protein O-mannosyl-transferase TMEM260, Transmembrane protein 260

---

Tested Applications

• Positive WB detected in: HepG2 cells, HuH-7 cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33682-1-AP targets TMEM260 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38950

  Product name: Recombinant human C14orf101 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 512-707 aa of NM_017799.3

  Sequence: EVNKQKETFVCIGIHEGDPTWKKNYSLWPWGSCDKLVPLEIVFNPEEWIKLTKSIYNWTEEYGRFDPSSWESVANEEMWQARMKTPFFIFNLAETAHMPSKVKAQLYAQAYDLYKEIVYLQKEHPVNWHKNYAIACERMLRLQARDADPEVLLSETIRHFRLYSQKAPNDPQQADILGALKHLRKELQSLRNRKNV

• Full Name: chromosome 14 open reading frame 101
• Calculated Molecular Weight: 80 kDa，707aa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: NM_017799.3
• Gene Symbol: C14orf101
• Gene ID (NCBI): 54916
• RRID: AB_3743048
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NX78
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.