Use Able AI chat for product recommendations

TMEM268 Polyclonal antibody, PBS Only

TMEM268 Polyclonal Antibody for IP, Indirect ELISA

Cat No. 28179-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IP, Indirect ELISA

C9orf91, FLJ38045, RP11 402G3.2, Transmembrane protein 268, Transmembrane protein C9orf91

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

28179-1-PBS targets TMEM268 in IP, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26867

Product name: Recombinant human C9orf91 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-299 aa of BC107134

Sequence: MVITQPDEASGLLPELHNGQVLTVLRIDNTCAPISFDLGAAEEQLQTWGIQVPADQYRSLAESALLEPQVRRYIIYNSRPMRLAFAVVFYVVVWANIYSTSQMFALGNHWAGMLLVTLAAVSLTLTLVLVFERHQKKANTNTDLRLAAANGALLRHRVLLGVTDTVEGCQSVIQLWFVYFDLENCVQFLSDHVQEMKTSQESLLRSRLSQLCVVMETGVSPATAEGPENLEDAPLLPGNSCPNERPLMQTELHQLVPEAEPEEMARQLLAVFGGYYIRLLVTSQLPQAMGTRHTNSPRI

Predict reactive species
Full Name chromosome 9 open reading frame 91
Observed Molecular Weight38 kDa
GenBank Accession NumberBC107134
Gene Symbol C9orf91
Gene ID (NCBI) 203197
RRIDAB_3742282
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ5VZI3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TMEM268 (Transmembrane Protein 268) is a membrane protein containing two transmembrane domains. It is primarily localized to the plasma membrane and is widely expressed in various tissues and cell types. This protein influences cell adhesion, cytoskeletal remodeling, and cell migration by regulating the stability of ITGB4 (integrin β4). In cancer research, TMEM268 is significantly overexpressed in gastric cancer, where it promotes tumor cell proliferation, adhesion, and metastasis. It serves as an independent prognostic marker for thyroid cancer, and its high expression is closely associated with poor patient survival. In the immune system, TMEM268 interacts with CD11b, regulates the β2 integrin signaling pathway, and participates in innate immune responses and pathogen clearance; its deficiency leads to increased susceptibility to sepsis. Furthermore, this protein has been identified as a component of the microglial membrane proteome, suggesting a potential role in neuroimmunology, and represents a potential therapeutic target for cancer and immune-related diseases.

Loading...
||
New chat

Able

正在加载,请稍候...