TMEM27 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82853-2-RR (same clone as 82853-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82853-2-RR (TMEM27 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82853-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 82853-2-RR (same clone as 82853-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 82853-2-RR (TMEM27 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82853-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 82853-2-RR (same clone as 82853-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 82853-2-RR (TMEM27 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82853-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82853-2-RR

  Biolayer interferometry (BLl) kinetic assays of 82853-2-RR against Human TMEM27 were performed. The affinity constant is below 1 pM.

TMEM27 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 82853-2-PBS

Clone No.240437C2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

NX17, NX 17, Collectrin, CLTRN, ACE2

---

Product Information

82853-2-PBS targets TMEM27 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7668

  Product name: Recombinant human TMEM27 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-143 aa of BC050606

  Sequence: VRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSVPIW

• Full Name: transmembrane protein 27
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: BC050606
• Gene Symbol: TMEM27
• Gene ID (NCBI): 57393
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9HBJ8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM27 (also termed collectrin), a 46 kDa type I transmembrane protein, is a homolog of the noncatalytic domain of angiotensin-converting enzyme-related carboxypeptidase (Ace2). Its expression has only been reported in the brush border membrane of the proximal tubules and collecting ducts of the kidney and in the pancreatic b cell (PMID: 11278314, 16330324). Overexpression of TMEM27 in b cells leads to increased proliferation in vitro and increased pancreatic b cell mass in vivo, and also has been reported to augment glucosestimulated ins secretion (GSIS) (PMID: 16330324, 16330323). The abundance of TMEM27 protein in b cells is furthermore regulated by ectodomain cleavage, which leads to two cleavage products, a 25 kDa N-terminal part that is released into the extracellular space (the shed fragment), and a 22 kDa C-terminal fragment (CTF) remaining in the membrane that is rapidly degraded (PMID: 16330324). TMEM27 is an N-glycosylated protein and can form dimers with MW of 64-75 kDa(patent US 20100119489 A1). TMEM27 can be used as a beta cell mass biomarker (PMID: 20386877, 21907142).