TMEM35 Recombinant monoclonal antibody

• 

  WB analysis using 86724-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86724-1-RR (TMEM35 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 86724-1-RR

  IP result of anti-TMEM35 (IP:86724-1-RR, 4ug; Detection:86724-1-RR 1:5000) with mouse brain tissue lysate 1960 ug.

• 

  IHC staining of mouse brain using 86724-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 86724-1-RR (TMEM35 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 86724-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86724-1-RR against Human TMEM35 were performed. The affinity constant is 2.31 nM.

TMEM35 Uni-rAb^® Recombinant Antibody for WB, IHC, IP, ELISA

Cat No. 86724-1-RR

Clone No.251680G5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IP, ELISA

Synonyms

NACHO, Novel acetylcholine receptor chaperone, TMEM35A, transmembrane protein 35

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue, mouse spinal cord tissue, rat spinal cord tissue, mouse cerebellum tissue, rat cerebellum tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86724-1-RR targets TMEM35 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20589

  Product name: Recombinant human TMEM35 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 125-167 aa of BC078658

  Sequence: LTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS

• Full Name: transmembrane protein 35
• Calculated Molecular Weight: 167 aa, 18 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC078658
• Gene Symbol: TMEM35
• Gene ID (NCBI): 59353
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q53FP2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM35 is a 167-amino acid peptide with a putative NH2 terminal signal peptide, three hydrophobic transmembrane domains, and a nerve growth factor binding domain.TMEM35is 18kDa and has been shown to localize to membrane-bound structures within cells.