Tested Applications
| Positive WB detected in | mouse liver tissue, mouse small intestine tissue, rat liver tissue, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20768-1-AP targets TMEM41A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14753 Product name: Recombinant human TMEM41A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC008043 Sequence: MRPLLGLLLVFAGCTFALYLLSTRLPRGRRLGSTEEAGGRSLWFPSDLAELRELSEVLREYRKEHQAYVFLLFCGAYLYK Predict reactive species |
| Full Name | transmembrane protein 41A |
| Calculated Molecular Weight | 264 aa, 30 kDa |
| Observed Molecular Weight | 26-28 kDa |
| GenBank Accession Number | BC008043 |
| Gene Symbol | TMEM41A |
| Gene ID (NCBI) | 90407 |
| RRID | AB_10693679 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96HV5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TMEM41A antibody 20768-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
J Cell Biol Genome-wide CRISPR screen identifies TMEM41B as a gene required for autophagosome formation.
| ||





