Featured Product
KD/KO Validated

TMEM41B Polyclonal antibody

TMEM41B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29270-1-AP

Publications (11)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Transmembrane protein 41B, KIAA0033

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of HeLa using 29270-1-AP
WB result of TMEM41B antibody (29270-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TMEM41B transfected HeLa cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 29270-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 29270-1-AP (TMEM41B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse lung using 29270-1-AP
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 29270-1-AP (TMEM41B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse lung using 29270-1-AP
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 29270-1-AP (TMEM41B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse testis using 29270-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29270-1-AP (TMEM41B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse testis using 29270-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29270-1-AP (TMEM41B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung using 29270-1-AP
Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 29270-1-AP (TMEM41B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung using 29270-1-AP
Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 29270-1-AP (TMEM41B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TMEM41B in ?

Overview

Tested Applications
Product Information
Publications (11)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A549 cells, HeLa cells
Positive IHC detected in	mouse lung tissue, mouse testis tissue, human lung tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:6000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29270-1-AP targets TMEM41B in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human, mouse, pig
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag30810 Product name: Recombinant human TMEM41B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC035034 Sequence: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGSARMSLLILVSIFLSAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTF Predict reactive species
Full Name	transmembrane protein 41B
Calculated Molecular Weight	32 kDa
Observed Molecular Weight	22-28 kDa
GenBank Accession Number	BC035034
Gene Symbol	TMEM41B
Gene ID (NCBI)	440026
RRID	AB_2918264
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q5BJD5
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transmembrane protein 41B (TMEM41B), also known as Stasimon, is a major target of survival motor neuron (SMN)-dependent U12 splicing and has been identified as a protein required for motor circuit function (PMID: 23063131). TMEM41B localizes to the endoplasmic reticulum. It is involved in autophagosome biogenesis and lipid mobilization (PMID: 30126924). TMEM41B has been shown to be essential for mouse embryonic development (PMID: 30352685). Additionally, genome-scale CRISPR knockout screens reveal that TMEM41B is required for infection of flavivirus and coronavirus, including SARS-CoV-2 (PMID: 33052348; 33052332). Alternative splicing results in three transcript variants encoding distinct isoforms.

Protocols

Product Specific Protocols
IHC protocol for TMEM41B antibody 29270-1-AP	Download protocol
WB protocol for TMEM41B antibody 29270-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-TMEM41B antibody (Cat# 29270-1-AP) has 11 total citations. Citations appear in Nature (×3), Cell Metabolism, Autophagy, Acta Pharmacologica Sinica, Cell Mol Gastroenterol Hepatol, Biomedicines, Journal of Virology, STAR Protocols, and bioRxiv. Research fields include lipid homeostasis, lipoprotein biogenesis and secretion, ER membrane scramblase activity, autophagy, viral infection (SARS-CoV-2, coronaviruses, pseudorabies virus), and liver disease/hepatocellular carcinoma.

Species	Application	Title
human	WB	Nature PLSCR1 is a cell-autonomous defence factor against SARS-CoV-2 infection Authors - Dijin Xu View Article
human,mouse	WB	Nature CLCC1 governs ER bilayer equilibration to maintain lipid homeostasis. Authors - Lingzhi Wu View Article
human	WB	Nature CLCC1 promotes hepatic neutral lipid flux and nuclear pore complex assembly. Authors - Alyssa J. Mathiowetz KO Validated View Article
mouse	WB,IF	Cell Metab TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis. Authors - Dong Huang KO Validated View Article
mouse	WB	Autophagy ATG9A-PLA2G6 axis reprograms phospholipid metabolism to drive metabolic liver disease and hepatocellular carcinoma. Authors - Qi Zhu View Article
human	WB	Acta Pharmacol Sin Carrimycin exhibited broad spectrum inhibitory activities against coronaviruses replication through down-regulating host factor TMEM41B Authors - Kun Wang View Article